Ptbp3 Rabbit Polyclonal Antibody

CAT#: TA345914

Rabbit Polyclonal Anti-Rod1 Antibody

Product Images

WB Suggested Anti-Rod1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rod1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: polypyrimidine tract binding protein 3
• Database Link:
  NP_659153
  Entrez Gene 230257 Mouse
  UniProt ID Q8BHD7
• Background: Rod1 may play a role in regulation of differentiation. In vitro, It binds RNA, preferentially to both poly(G) and poly(U)
• Synonyms: 5830471K22Rik; AA407443; AI462022; AW107884; C86549; Rod1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Dog: 79%