hnRNP Q (SYNCRIP) Rabbit Polyclonal Antibody

CAT#: TA345956

Rabbit Polyclonal Anti-SYNCRIP Antibody

Product Images

WB Suggested Anti-SYNCRIP Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the N terminal of human SYNCRIP. Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: synaptotagmin binding cytoplasmic RNA interacting protein
• Database Link:
  NP_006363
  Entrez Gene 10492 Human
  UniProt ID O60506
• Background: Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.
• Synonyms: GRY-RBP; GRYRBP; hnRNP-Q; HNRNPQ; HNRPQ1; NSAP1; PP68
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency