IGF2BP1 Rabbit Polyclonal Antibody

CAT#: TA345972

Rabbit Polyclonal Anti-IGF2BP1 Antibody

Product Images

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

• 

  Sample Type: Human lung adenocarcinoma Primary Antibody Dilution: 1: 300; Secondary Antibody: Anti-rabbit-linker, Fbex-HRP; Secondary Antibody: ilution: NOT FOUND; Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei; Gene Name: IGF2BP1; Submitted by: Haodong Xu. Department of Pathology, University of Rochester medical Center

• 

  Researcher: Haodong Xu. Department of Pathology, University of Rochester medical Center; Application: IHC; Species+tissue/cell type: Human lung adenocarcinoma; Primary antibody dilution: 1: 300; Secondary antibody: Anti-rabbit-linker, Fbex-HRP; Secondary antibody dilution: NOT FOUND

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal of human IGF2BP1. Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: insulin like growth factor 2 mRNA binding protein 1
• Database Link:
  NP_006537
  Entrez Gene 303477 RatEntrez Gene 10642 Human
  UniProt ID Q9NZI8
• Background: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CRD-BP; CRDBP; IMP-1; IMP1; VICKZ1; ZBP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%