WDR6 Rabbit Polyclonal Antibody

CAT#: TA346001

Rabbit Polyclonal Anti-WDR6 Antibody

Product Images

WB Suggested Anti-WDR6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateWDR6 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-WDR6 Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR6 antibody: synthetic peptide directed towards the C terminal of human WDR6. Synthetic peptide located within the following region: TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: WD repeat domain 6
• Database Link:
  NP_060501
  Entrez Gene 11180 Human
  UniProt ID Q9NNW5
• Background: WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
• Synonyms: FLJ10218; FLJ52552; FLJ56107; MGC126756; MGC142027
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%