ketohexokinase (KHK) Rabbit Polyclonal Antibody

CAT#: TA346029

Rabbit Polyclonal Anti-KHK Antibody

Product Images

WB Suggested Anti-KHK Antibody; Titration: 1 ug/ml; Positive Control: Fetal liver cell lysate

• 

  Rabbit Anti-KHK Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: ketohexokinase
• Database Link:
  NP_006479
  Entrez Gene 3795 Human
  UniProt ID P50053
• Background: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.
• Synonyms: ketohexokinase; ketohexokinase (fructokinase)
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways