DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody

CAT#: TA346050

Rabbit Polyclonal Anti-DDC Antibody

Product Images

WB Suggested Anti-DDC Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysateDDC is supported by BioGPS gene expression data to be expressed in HepG2

• 

  3Human 293T; WB Suggested Anti-DDC Antibody Titration: 1 ug/ml; Positive Control: Human 293T cell lysate

• 

  Rabbit Anti-DDC Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: dopa decarboxylase
• Database Link:
  NP_000781
  Entrez Gene 1644 Human
  UniProt ID P20711
• Background: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
• Synonyms: AADC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Rat: 92%; Bovine: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism