Claudin18 (CLDN18) Rabbit Polyclonal Antibody

CAT#: TA346055

Rabbit Polyclonal Anti-CLDN18 Antibody

Product Images

WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: claudin 18
• Database Link:
  NP_001002026
  Entrez Gene 51208 Human
  UniProt ID P56856
• Background: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.
• Synonyms: SFTA5; SFTPJ
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction