EMP2 Rabbit Polyclonal Antibody

CAT#: TA346075

Rabbit Polyclonal Anti-EMP2 Antibody

Product Images

WB Suggested Anti-EMP2 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-EMP2 Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EMP2 antibody: synthetic peptide directed towards the middle region of human EMP2. Synthetic peptide located within the following region: IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: epithelial membrane protein 2
• Database Link:
  NP_001415
  Entrez Gene 2013 Human
  UniProt ID P54851
• Background: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognized as a putative tumor suppressor gene in certain model systems.
• Synonyms: XMP
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 82%

Reference Data

• Protein Families: Transmembrane