Tartrate Resistant Acid Phosphatase (ACP5) Rabbit Polyclonal Antibody

CAT#: TA346076

Rabbit Polyclonal Anti-ACP5 Antibody

Product Images

WB Suggested Anti-ACP5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: acid phosphatase 5, tartrate resistant
• Database Link:
  NP_001602
  Entrez Gene 54 Human
  UniProt ID P13686
• Background: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.
• Synonyms: HPAP; TRACP5a; TRACP5b; TRAP; TrATPase
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysosome, Riboflavin metabolism