EGF Rabbit Polyclonal Antibody

CAT#: TA346085

Rabbit Polyclonal Anti-EGF Antibody

Product Images

WB Suggested Anti-EGF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 6 kDa
• Gene Name: epidermal growth factor
• Database Link:
  NP_001954
  Entrez Gene 1950 Human
  UniProt ID P01133
• Background: Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.
• Synonyms: HOMG4; URG
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Mouse: 79%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane
• Protein Pathways: Bladder cancer, Cytokine-cytokine receptor interaction, Endocytosis, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton