MFAP4 Rabbit Polyclonal Antibody

CAT#: TA346088

Rabbit Polyclonal Anti-MFAP4 Antibody

Product Images

WB Suggested Anti-MFAP4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate

• 

  Sample Type: Mouse sciatic nerve Primary Antibody Dilution: 1: 500; Secondary Antibody: Biotinylated Anti-Rabbit 1: 1000 followed by avidin-biotin and diaminobenzidine; Secondary Antibody: ilution: 1: 1000; Gene Name: MFAP4; Submitted by: Beth Friedman, Ph.D., Project Scientist, Department of Pharmacology, UCSD School of Medicine, San Diego, CA

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFAP4 antibody: synthetic peptide directed towards the N terminal of human MFAP4. Synthetic peptide located within the following region: TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: microfibrillar associated protein 4
• Database Link:
  NP_002395
  Entrez Gene 76293 Mouse
  UniProt ID P55083
• Background: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region.
• Synonyms: microfibril-associated glycoprotein 4; microfibrillar-associated protein 4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein