ketohexokinase (KHK) Rabbit Polyclonal Antibody

CAT#: TA346115

Rabbit Polyclonal Anti-KHK Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b
    • 20 ug

USD 823.00


Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant b
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name ketohexokinase
Background KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.
Synonyms ketohexokinase; ketohexokinase (fructokinase)
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.