ketohexokinase (KHK) Rabbit Polyclonal Antibody

CAT#: TA346115

Rabbit Polyclonal Anti-KHK Antibody

Product Images

WB Suggested Anti-KHK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: ketohexokinase
• Database Link:
  NP_006479
  Entrez Gene 3795 Human
  UniProt ID P50053
• Background: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.
• Synonyms: ketohexokinase; ketohexokinase (fructokinase)
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways