SDS Rabbit Polyclonal Antibody

CAT#: TA346122

Rabbit Polyclonal Anti-SDS Antibody

Product Images

WB Suggested Anti-SDS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SDS antibody: synthetic peptide directed towards the middle region of human SDS. Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: serine dehydratase
• Database Link:
  NP_006834
  Entrez Gene 10993 Human
  UniProt ID P20132
• Background: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.
• Synonyms: SDH
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways