VSIG4 Rabbit Polyclonal Antibody

CAT#: TA346124

Rabbit Polyclonal Anti-VSIG4 Antibody

Product Images

WB Suggested Anti-VSIG4 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VSIG4 antibody: synthetic peptide directed towards the N terminal of human VSIG4. Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: V-set and immunoglobulin domain containing 4
• Database Link:
  NP_009199
  Entrez Gene 11326 Human
  UniProt ID Q9Y279
• Background: T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
• Synonyms: CRIg; Z39IG
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 91%; Rat: 86%; Rabbit: 82%

Reference Data

• Protein Families: Transmembrane