HMGCL Rabbit Polyclonal Antibody

CAT#: TA346165

Rabbit Polyclonal Anti-HMGCL Antibody

Product Images

WB Suggested Anti-HMGCL Antibody Titration: 1.25 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase
• Database Link:
  NP_000182
  Entrez Gene 3155 Human
  UniProt ID P35914
• Background: The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.
• Synonyms: HL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation