HMGCL Rabbit Polyclonal Antibody

CAT#: TA346165

Rabbit Polyclonal Anti-HMGCL Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL)
    • 20 ug

USD 823.00


Transient overexpression lysate of 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "HMGCL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name 3-hydroxymethyl-3-methylglutaryl-CoA lyase
Background The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.
Synonyms HL
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Zebrafish: 91%
Reference Data
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.