Protein C (PROC) Rabbit Polyclonal Antibody

CAT#: TA346173

Rabbit Polyclonal Anti-PROC Antibody

Product Images

WB Suggested Anti-PROC Antibody Titration: 2.5 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: protein C, inactivator of coagulation factors Va and VIIIa
• Database Link:
  NP_000303
  Entrez Gene 5624 Human
  UniProt ID P04070
• Background: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.
• Synonyms: APC; PC; PROC1; THPH3; THPH4
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rat: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades