Steroid sulfatase (STS) Rabbit Polyclonal Antibody

CAT#: TA346178

Rabbit Polyclonal Anti-STS Antibody

Product Images

WB Suggested Anti-STS Antibody Titration: 5.0 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STS antibody: synthetic peptide directed towards the C terminal of human STS. Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: steroid sulfatase (microsomal), isozyme S
• Database Link:
  NP_000342
  Entrez Gene 412 Human
  UniProt ID P08842
• Background: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).
• Synonyms: ARSC; ARSC1; ASC; ES; SSDD; XLI
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Pig: 77%; Rat: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism