TSH Receptor (TSHR) Rabbit Polyclonal Antibody

CAT#: TA346180

Rabbit Polyclonal Anti-TSHR Antibody

Product Images

Sample Type: Nthy-ori cell lysate (50ug); Primary Dilution: 1: 1000; Secondary Antibody: anti-rabbit HRP; Secondary Dilution: 1: 2000; Image Submitted By: Anonymous

• 

  WB Suggested Anti-TSHR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: thyroid stimulating hormone receptor
• Database Link:
  NP_000360
  Entrez Gene 7253 Human
  UniProt ID P16473
• Background: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
• Synonyms: CHNG1; hTSHR-I; LGR3
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Autoimmune thyroid disease, Neuroactive ligand-receptor interaction