Amylin (IAPP) Rabbit Polyclonal Antibody

CAT#: TA346186

Rabbit Polyclonal Anti-IAPP Antibody

Product Images

WB Suggested Anti-IAPP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP. Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 4 kDa
• Gene Name: islet amyloid polypeptide
• Database Link:
  NP_000406
  Entrez Gene 3375 Human
  UniProt ID P10997
• Background: Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.
• Synonyms: DAP; IAP
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Rabbit: 86%; Bovine: 82%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Maturity onset diabetes of the young