ABCB4 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "ABCB4"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 141 kDa |
| Gene Name | ATP binding cassette subfamily B member 4 |
| Database Link | |
| Background | ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member |
| Synonyms | 3; ABC21; GBD1; ICP3; MDR2; MDR3; PFIC-3; PGY3 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | ABC transporters |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China