ABCB4 Rabbit Polyclonal Antibody

CAT#: TA346194

Rabbit Polyclonal Anti-ABCB4 Antibody

Product Images

WB Suggested Anti-ABCB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysateABCB4 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 141 kDa
• Gene Name: ATP binding cassette subfamily B member 4
• Database Link:
  NP_000434
  Entrez Gene 5244 Human
  UniProt ID P21439
• Background: ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member
• Synonyms: 3; ABC21; GBD1; ICP3; MDR2; MDR3; PFIC-3; PGY3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters