Prothrombin (F2) Rabbit Polyclonal Antibody

CAT#: TA346200

Rabbit Polyclonal Anti-F2 Antibody

Product Images

WB Suggested Anti-F2 Antibody; Titration: 1 ug/ml; Positive Control: 721_B cell lysate

• 

  Anti-F2 / Thrombin antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Anti-F2 / Thrombin antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Rabbit Anti-F2 Antibody; Paraffin Embedded Tissue: Human Placenta; Antibody Concentration: 5 ug/ml

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: coagulation factor II, thrombin
• Database Link:
  NP_000497
  Entrez Gene 2147 Human
  UniProt ID P00734
• Background: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life.Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: PT; RPRGL2; THPH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton