C Reactive Protein (CRP) Rabbit Polyclonal Antibody

CAT#: TA346207

Rabbit Polyclonal Anti-CRP Antibody

Product Images

WB Suggested Anti-CRP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRP antibody: synthetic peptide directed towards the N terminal of human CRP. Synthetic peptide located within the following region: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25
• Gene Name: C-reactive protein, pentraxin-related
• Database Link:
  NP_000558
  Entrez Gene 1401 Human
  UniProt ID P02741
• Background: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.
• Synonyms: PTX1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 92%; Rabbit: 92%; Pig: 86%; Guinea pig: 86%; Horse: 85%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein