ADH6 Rabbit Polyclonal Antibody

CAT#: TA346214

Rabbit Polyclonal Anti-ADH6 Antibody

Product Images

WB Suggested Anti-ADH6 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysateADH6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: alcohol dehydrogenase 6 (class V)
• Database Link:
  NP_000663
  Entrez Gene 130 Human
  UniProt ID P28332
• Background: ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
• Synonyms: ADH-5
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism