Cytochrome P450 2B6 (CYP2B6) Rabbit Polyclonal Antibody

CAT#: TA346223

Rabbit Polyclonal Anti-CYP2B6 Antibody

Product Images

WB Suggested Anti-CYP2B6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cytochrome P450 family 2 subfamily B member 6
• Database Link:
  NP_000758
  Entrez Gene 1555 Human
  UniProt ID P20813
• Background: This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]
• Synonyms: CPB6; CYP2B; CYP2B7; CYP2B7P; CYPIIB6; EFVM; IIB1; P450
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 82%; Guinea pig: 82%; Horse: 79%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, P450
• Protein Pathways: Arachidonic acid metabolism, Drug metabolism - cytochrome P450, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism