MAGEA10 Rabbit Polyclonal Antibody

CAT#: TA346249

Rabbit Polyclonal Anti-MAGEA10 Antibody

Product Images

WB Suggested Anti-MAGEA10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAGEA10 antibody: synthetic peptide directed towards the middle region of human MAGEA10. Synthetic peptide located within the following region: NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: MAGE family member A10
• Database Link:
  NP_001011543
  Entrez Gene 4109 Human
  UniProt ID P43363
• Background: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: CT1.10; MAGE10
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Rabbit: 86%