MAGEA10 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of melanoma antigen family A, 10 (MAGEA10), transcript variant 1
USD 436.00
Other products for "MAGEA10"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MAGEA10 antibody: synthetic peptide directed towards the middle region of human MAGEA10. Synthetic peptide located within the following region: GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 41 kDa |
| Gene Name | MAGE family member A10 |
| Database Link | |
| Background | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene. |
| Synonyms | CT1.10; MAGE10 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Horse: 91%; Mouse: 91%; Guinea pig: 90%; Rabbit: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China