TSH Receptor (TSHR) Rabbit Polyclonal Antibody

CAT#: TA346254

Rabbit Polyclonal Anti-TSHR Antibody

Product Images

WB Suggested Anti-TSHR Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TSHR is expressed in Jurkat

• 

  Host: Rabbit; Target Name: TSHR; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 2.5 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12%There is BioGPS gene expression data showing that TSHR is expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: thyroid stimulating hormone receptor
• Database Link:
  NP_001018046
  Entrez Gene 7253 Human
  UniProt ID P16473
• Background: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
• Synonyms: CHNG1; hTSHR-I; LGR3
• Note: Immunogen Sequence Homology: Human: 100%; Sheep: 100%; Bovine: 93%; Dog: 86%; Horse: 86%; Rat: 79%; Mouse: 79%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Autoimmune thyroid disease, Neuroactive ligand-receptor interaction