DHODH Rabbit Polyclonal Antibody

CAT#: TA346256

Rabbit Polyclonal Anti-DHODH Antibody

Product Images

WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: dihydroorotate dehydrogenase (quinone)
• Database Link:
  NP_001352
  Entrez Gene 1723 Human
  UniProt ID Q02127
• Background: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
• Synonyms: DHOdehase; POADS; URA1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Pyrimidine metabolism