PSG6 Rabbit Polyclonal Antibody

CAT#: TA346260

Rabbit Polyclonal Anti-PSG6 Antibody

Product Images

WB Suggested Anti-PSG6 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSG6 antibody: synthetic peptide directed towards the N terminal of human PSG6. Synthetic peptide located within the following region: VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: pregnancy specific beta-1-glycoprotein 6
• Database Link:
  NP_001027020
  Entrez Gene 5675 Human
  UniProt ID Q00889
• Background: PSG6 may have a role in modulation of the innate immune system.
• Synonyms: PSBG-6; PSBG-10; PSBG-12; PSG10; PSGGB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 90%; Rat: 90%; Mouse: 90%; Guinea pig: 90%; Horse: 79%

Reference Data

• Protein Families: Secreted Protein