RHOBTB1 Rabbit Polyclonal Antibody

CAT#: TA346261

Rabbit Polyclonal Anti-RHOBTB1 Antibody

Product Images

WB Suggested Anti-RHOBTB1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: RHOBTB1; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 4.0 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12%

• 

  Rabbit Anti-RHOBTB1 Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHOBTB1 antibody: synthetic peptide directed towards the middle region of human RHOBTB1. Synthetic peptide located within the following region: DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: Rho related BTB domain containing 1
• Database Link:
  NP_055651
  Entrez Gene 9886 Human
  UniProt ID O94844
• Background: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate transcriptional splice variants have been characterized.
• Synonyms: KIAA0740; MGC33059; MGC33841
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 79%