CRMP1 Rabbit Polyclonal Antibody

CAT#: TA346283

Rabbit Polyclonal Anti-CRMP1 Antibody

Product Images

WB Suggested Anti-CRMP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: collapsin response mediator protein 1
• Database Link:
  NP_001304
  Entrez Gene 12933 MouseEntrez Gene 1400 Human
  UniProt ID Q14194
• Background: CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.
• Synonyms: CRMP-1; DPYSL1; DRP-1; DRP1; ULIP-3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Rabbit: 86%; Zebrafish: 86%