CRMP1 Rabbit Polyclonal Antibody

CAT#: TA346284

Rabbit Polyclonal Anti-CRMP1 Antibody

Product Images

WB Suggested Anti-CRMP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

• 

  Sample Type: �2. mouse brain extracts (80ug); 3. rat brain extract� (80ug); Primary Antibody Dilution: �2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: �1: 20, 000; Image Submitted by: Yuzhi Chen; University of Arkansas for Medical Science�

• 

  Sample Type: �NT2 cells; Red: �Antibody; Blue: �DAPI; Primary Dilution: �1 ug/50ul antibody; Secondary Antibody: �Alexa goat anti-rabbit 594; Image Submitted by: �Yuzhi Chen, University of Arkansas for Medical Sciences �

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: collapsin response mediator protein 1
• Database Link:
  NP_001304
  Entrez Gene 12933 MouseEntrez Gene 25415 RatEntrez Gene 1400 Human
  UniProt ID Q14194
• Background: CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.
• Synonyms: CRMP-1; DPYSL1; DRP-1; DRP1; ULIP-3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%; Rabbit: 86%; Zebrafish: 86%