Ambp Rabbit Polyclonal Antibody

CAT#: TA346300

Rabbit Polyclonal Anti-Ambp Antibody

Product Images

WB Suggested Anti-Ambp Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Rat Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ambp antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: alpha-1-microglobulin/bikunin precursor
• Database Link:
  NP_037033
  Entrez Gene 25377 Rat
  UniProt ID Q64240
• Background: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.
• Synonyms: A1M; alpha-1-microglobulin/bikunin; bikunin; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; trypstatin; uristatin; UTI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 86%; Guinea pig: 86%