BDNF Rabbit Polyclonal Antibody

CAT#: TA346304

Rabbit Polyclonal Anti-BDNF Antibody

Product Images

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: BDNF; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: BDNF; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 0.5 ug/ml

• 

  Sample Type: Rhesus macaque spinal cord Primary Antibody Dilution: 1: 300; Secondary Antibody: Donkey anti Rabbit 488; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Green: BDNF; Gene Name: BDNF;

• 

  Sample Type: Ventral horn region of mouse spinal cord Primary Antibody Dilution: 1: 200; Secondary Antibody: Donkey anti-rabbit CY2; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Green: BDNF; Gene Name: BDNF;

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Macaque, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: brain-derived neurotrophic factor
• Database Link:
  NP_001700
  Entrez Gene 12064 MouseEntrez Gene 627 Human
  UniProt ID P23560
• Background: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
• Synonyms: ANON2; BULN2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane
• Protein Pathways: Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway