MMP3 Rabbit Polyclonal Antibody

CAT#: TA346323

Rabbit Polyclonal Anti-MMP3 Antibody

Product Images

MMP3 antibody - middle region validated by WB using Articular cartilage secretome at 1: 1000.

• 

  Sample Type: Equine Cartilage ExplantsPrimary Dilution: 1: 1000Secondary: Abcam ab97200 (Dilution: 1: 20, 000)

• 

  WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

• 

  Application: IHC; Species+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancer; Primary antibody dilution: 1: 100; Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: matrix metallopeptidase 3
• Database Link:
  NP_002413
  Entrez Gene 4314 Human
  UniProt ID P08254
• Background: MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.
• Synonyms: CHDS6; MMP-3; SL-1; STMY; STMY1; STR1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Horse: 86%; Sheep: 79%; Bovine: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease