Rasa1 Rabbit Polyclonal Antibody

CAT#: TA346333

Rabbit Polyclonal Anti-Rasa1 Antibody

Product Images

WB Suggested Anti-Rasa1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rasa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: RAS p21 protein activator 1
• Database Link:
  NP_663427
  Entrez Gene 218397 Mouse
• Background: The function of this protein remains unknown.
• Synonyms: CM-AVM; CMAVM; DKFZp434N071; GAP; p120GAP; p120RASGAP; PKWS; RASA; RASGAP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 85%