Semenogelin I (SEMG1) Rabbit Polyclonal Antibody

CAT#: TA346338

Rabbit Polyclonal Anti-SEMG1 Antibody

Product Images

WB Suggested Anti-SEMG1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate.SEMG1 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEMG1 antibody: synthetic peptide directed towards the middle region of human SEMG1. Synthetic peptide located within the following region: KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: semenogelin I
• Database Link:
  NP_937782
  Entrez Gene 6406 Human
  UniProt ID P04279
• Background: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly
• Synonyms: CT103; MGC14719; RATSVPIIA; secretion 2; semenogelin I; SEMG; seminal vesicle protein; seminal vesicle secretory protein 2; SGI; SVPIIA; Svs2; Svs2p2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%

Reference Data

• Protein Families: Secreted Protein