LEFTY2 Rabbit Polyclonal Antibody

CAT#: TA346347

Rabbit Polyclonal Anti-LEFTY2 Antibody

Product Images

Host: Rabbit; Target Name: LEFTY2; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LEFTY2 antibody is: synthetic peptide directed towards the N-terminal region of Human LEFTY2. Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: left-right determination factor 2
• Database Link:
  NP_003231
  Entrez Gene 7044 Human
  UniProt ID O00292
• Background: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.
• Synonyms: EBAF; LEFTA; LEFTYA; TGFB4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 83%; Rat: 83%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: TGF-beta signaling pathway