Uridine Phosphorylase 1 (UPP1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1
USD 823.00
Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1
USD 396.00
Other products for "UPP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UPP1 antibody: synthetic peptide directed towards the N terminal of human UPP1. Synthetic peptide located within the following region: AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Gene Name | uridine phosphorylase 1 |
Database Link | |
Background | UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. |
Synonyms | UDRPASE; UP; UPASE; UPP |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 85%; Bovine: 85%; Horse: 83%; Zebrafish: 83%; Pig: 75%; Guinea pig: 75% |
Reference Data | |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.