VGF Rabbit Polyclonal Antibody

CAT#: TA346358

Rabbit Polyclonal Anti-VGF Antibody

Product Images

WB Suggested Anti-VGF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VGF antibody: synthetic peptide directed towards the middle region of human VGF. Synthetic peptide located within the following region: VRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: VGF nerve growth factor inducible
• Database Link:
  NP_003369
  Entrez Gene 7425 Human
  UniProt ID O15240
• Background: VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known. This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.
• Synonyms: SCG7; SgVII
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 92%; Dog: 91%; Rat: 91%; Zebrafish: 91%; Mouse: 86%; Pig: 85%; Horse: 85%

Reference Data

• Protein Families: Secreted Protein