ATP2A1 Rabbit Polyclonal Antibody

CAT#: TA346377

Rabbit Polyclonal Anti-ATP2A1 Antibody

Product Images

WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

• 

  Sample Type: Rhesus macaque spinal cord Primary Antibody Dilution: 1: 300; Secondary Antibody: Donkey anti Rabbit 488; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Green: ATP2A1; Gene Name: ATP2A1; Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Macaque
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 109 kDa
• Gene Name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
• Database Link:
  NP_004311
  Entrez Gene 487 Human
  UniProt ID O14983
• Background: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
• Synonyms: ATP2A; SERCA1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 85%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway