ALS (IGFALS) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human insulin-like growth factor binding protein, acid labile subunit (IGFALS)
USD 823.00
Transient overexpression lysate of insulin-like growth factor binding protein, acid labile subunit (IGFALS), transcript variant 2
USD 436.00
Other products for "IGFALS"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 63 kDa |
| Gene Name | insulin like growth factor binding protein acid labile subunit |
| Database Link | |
| Background | IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. |
| Synonyms | ACLSD; ALS |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China