ALS (IGFALS) Rabbit Polyclonal Antibody

CAT#: TA346389

Rabbit Polyclonal Anti-IGFALS Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human insulin-like growth factor binding protein, acid labile subunit (IGFALS)
    • 20 ug

USD 823.00


Transient overexpression lysate of insulin-like growth factor binding protein, acid labile subunit (IGFALS), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "IGFALS"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 63 kDa
Gene Name insulin like growth factor binding protein acid labile subunit
Background Adaptor proteins are usually required for transcriptional activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter.TADA3L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis.
Synonyms ACLSD; ALS
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.