Glycerol 3 Phosphate Dehydrogenase (GPD1) Rabbit Polyclonal Antibody

CAT#: TA346401

Rabbit Polyclonal Anti-GPD1 Antibody

Product Images

WB Suggested Anti-GPD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPD1 antibody: synthetic peptide directed towards the middle region of human GPD1. Synthetic peptide located within the following region: TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: glycerol-3-phosphate dehydrogenase 1
• Database Link:
  NP_005267
  Entrez Gene 2819 Human
  UniProt ID P21695
• Background: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
• Synonyms: GPD-C; GPDH-C; HTGTI
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Yeast: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Glycerophospholipid metabolism