Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human pregnancy specific beta-1-glycoprotein 1 (PSG1)
USD 439.00
Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 1 (PSG1)
USD 436.00
Other products for "PSG1"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the N terminal of human PSG1. Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 47 kDa |
| Gene Name | pregnancy specific beta-1-glycoprotein 1 |
| Database Link | |
| Background | The function remains unknown. |
| Synonyms | 2; B1G1; CD66f; D; DHFRP2; FL-NCA-1; PBG1; PS-beta-C; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Families | Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China