Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody

CAT#: TA346443

Rabbit Polyclonal Anti-PSG1 Antibody

Product Images

WB Suggested Anti-PSG1 Antibody Titration: 2.5 ug/ml; Positive Control: NCI-H226 cell lysate.PSG1 is strongly supported by BioGPS gene expression data to be expressed in Human NCI-H226 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the C terminal of human PSG1. Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: pregnancy specific beta-1-glycoprotein 1
• Database Link:
  NP_008836
  Entrez Gene 5669 Human
  UniProt ID P11464
• Background: The function remains unknown.
• Synonyms: 2; B1G1; CD66f; D; DHFRP2; FL-NCA-1; PBG1; PS-beta-C; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein