Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody

CAT#: TA346443

Rabbit Polyclonal Anti-PSG1 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human pregnancy specific beta-1-glycoprotein 1 (PSG1)
    • 20 ug

USD 439.00


Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 1 (PSG1)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "PSG1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the C terminal of human PSG1. Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name pregnancy specific beta-1-glycoprotein 1
Background The function remains unknown.
Synonyms 2; B1G1; CD66f; D; DHFRP2; FL-NCA-1; PBG1; PS-beta-C; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.