Acid Phosphatase (ACP1) Rabbit Polyclonal Antibody

CAT#: TA346451

Rabbit Polyclonal Anti-ACP1 Antibody

Product Images

WB Suggested Anti-ACP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate; ACP1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18
• Gene Name: acid phosphatase 1, soluble
• Database Link:
  NP_009030
  Entrez Gene 52 Human
  UniProt ID P24666
• Background: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.
• Synonyms: HAAP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Dog: 86%; Rat: 86%; Goat: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Transmembrane
• Protein Pathways: Adherens junction, Riboflavin metabolism