SARDH Rabbit Polyclonal Antibody

CAT#: TA346453

Rabbit Polyclonal Anti-SARDH Antibody

Product Images

Host: Rabbit; Target Name: SARDH; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SARDH antibody is: synthetic peptide directed towards the C-terminal region of Human SARDH. Synthetic peptide located within the following region: SLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: sarcosine dehydrogenase
• Database Link:
  NP_001128179
  Entrez Gene 1757 Human
  UniProt ID Q9UL12
• Background: The function of this protein remains unknown.
• Synonyms: BPR-2; DMGDHL1; SAR; SARD; SDH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways