TNNI3K Rabbit Polyclonal Antibody

CAT#: TA346506

Rabbit Polyclonal Anti-TNNI3K Antibody

Product Images

WB Suggested Anti-TNNI3K Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNNI3K antibody: synthetic peptide directed towards the middle region of human TNNI3K. Synthetic peptide located within the following region: PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: TNNI3 interacting kinase
• Database Link:
  NP_057062
  Entrez Gene 51086 Human
  UniProt ID Q59H18
• Background: This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology. [provided by RefSeq, Sep 2012]
• Synonyms: CARK; CCDD
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Dog: 92%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase