PAX8 Rabbit Polyclonal Antibody

CAT#: TA346519

Rabbit Polyclonal Anti-PAX8 Antibody

Product Images

Host: Rabbit; Target Name: PAX8; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: paired box 8
• Database Link:
  NP_003457
  Entrez Gene 7849 Human
  UniProt ID Q06710
• Background: This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]
• Synonyms: OTTHUMP00000158659; OTTHUMP00000158660; paired box 8; paired domain gene 8
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 87%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Thyroid cancer